Recoverin Polyclonal antibody

• 

  WB analysis using 10073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10073-1-AP (Recoverin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat retina using 10073-1-AP

  rat retina tissue were subjected to SDS PAGE followed by western blot with 10073-1-AP (Recoverin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 10073-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 10073-1-AP (RCVRN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse eye using 10073-1-AP

  IP result of anti-Recoverin (IP:10073-1-AP, 4ug; Detection:10073-1-AP 1:1000) with mouse eye tissue lysate 2680 ug.

• 

  IF Staining of mouse brain using 10073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Recoverin antibody (10073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse eye using 10073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Recoverin antibody (10073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Recoverin Polyclonal Antibody for WB, IF-P, IP, ELISA

Cat No. 10073-1-AP

Publications(21)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

RCVRN, Cancer associated retinopathy protein, Cancer-associated retinopathy protein, Protein CAR, RCV1

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat retina tissue, Y79 cells, rat eye tissue
• Positive IP detected in: mouse eye tissue
• Positive IF-P detected in: mouse eye tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 3 publications below
• IF: See 12 publications below

Product Information

10073-1-AP targets Recoverin in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0119

  Product name: Recombinant human Recoverin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-166 aa of BC001720

  Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK

• Full Name: recoverin
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001720
• Gene Symbol: Recoverin
• Gene ID (NCBI): 5957
• RRID: AB_2178005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35243
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Neurosci; Differentiation of marrow stromal cells into photoreceptors in the rat eye.; Authors - Kicic Anthony A
mouse	WB	iScience; Identification of early-onset photoreceptor degeneration in transgenic mouse models of Alzheimer's disease.; Authors - Jie Zhang
human	IF	iScience; A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation.; Authors - Suguru Yamasaki
human	IF	iScience; One-step induction of photoreceptor-like cells from human iPSCs by delivering transcription factors.; Authors - Yuki Otsuka
human	IF	Sci Rep; Preconditioning the Initial State of Feeder-free Human Pluripotent Stem Cells Promotes Self-formation of Three-dimensional Retinal Tissue.; Authors - Atsushi Kuwahara
mouse	IF	Sci Rep; Microglia dynamics in retinitis pigmentosa model: formation of fundus whitening and autofluorescence as an indicator of activity of retinal degeneration.; Authors - Kenichi Makabe

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alessandro (Verified Customer) (07-27-2022)

No aspecific staining, great outcome

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: ROs