CoraLite® Plus 488-conjugated RNASEL Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-22577

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 RNASEL antibody (CL488-22577) at dilution of 1:200.

RNASEL Polyclonal Antibody for IF/ICC

Cat No. CL488-22577

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

RNase L, 2-5A-dependent ribonuclease, 2-5A-dependent RNase, EC:3.1.26.-, RNS 4

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22577 targets RNASEL in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17409

  Product name: Recombinant human RNASEL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 392-741 aa of BC115697

  Sequence: KTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFAQNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEELKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC

• Full Name: ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
• Calculated Molecular Weight: 741 aa, 84 kDa
• Observed Molecular Weight: 84 kDa; 73 kDa
• GenBank Accession Number: BC115697
• Gene Symbol: RNASEL
• Gene ID (NCBI): 6041
• RRID: AB_3672745
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05823
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RNASEL, also named as RNS4, is an endoribonuclease that functions in the interferon (IFN) antiviral response. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. There're some isoforms with calculated MW 84 kDa and 73 kDa.