RNASEL Polyclonal antibody

• 

  WB analysis using 22577-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 22577-1-AP (RNASEL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 22577-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 22577-1-AP (RNASEL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 22577-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22577-1-AP (RNASEL Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human tonsillitis using 22577-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22577-1-AP (RNASEL Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 22577-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 22577-1-AP (RNASEL Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 22577-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 22577-1-AP (RNASEL Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 22577-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RNASEL antibody (22577-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

RNASEL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22577-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RNase L, RNS4, RNS 4, EC:3.1.26.-, 2-5A-dependent RNase

---

Tested Applications

• Positive WB detected in: THP-1 cells, RAW 264.7 cells
• Positive IHC detected in: human tonsillitis tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 1 publications below
• ELISA: See 1 publications below

Product Information

22577-1-AP targets RNASEL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17409

  Product name: Recombinant human RNASEL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 392-741 aa of BC115697

  Sequence: KTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFAQNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEELKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC

• Full Name: ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
• Calculated Molecular Weight: 741 aa, 84 kDa
• Observed Molecular Weight: 84 kDa; 73 kDa
• GenBank Accession Number: BC115697
• Gene Symbol: RNASEL
• Gene ID (NCBI): 6041
• RRID: AB_2631036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q05823
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNASEL, also named as RNS4, is an endoribonuclease that functions in the interferon (IFN) antiviral response. RNASEL mediated apoptosis is the result of a JNK-dependent stress-response pathway leading to cytochrome c release from mitochondria and caspase-dependent apoptosis. There're some isoforms with calculated MW 84 kDa and 73 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes; Authors - Dario F De Jesus
human	wb	Adv Sci (Weinh); The CRISPR-Cas13a Gene-Editing System Induces Collateral Cleavage of RNA in Glioma Cells.; Authors - Qixue Wang
human	WB	Virol Sin; IFN-β1b induces OAS3 to inhibit EV71 via IFN-β1b/JAK/STAT1 pathway; Authors - Baisong Zheng
mouse,rat	IF	Apoptosis; The function of RNase L and its degradation mechanism in cardiac acute ischemic injury.; Authors - Qiang Ma
		Cardiovasc Diabetol; Human serum RNase-L level is inversely associated with metabolic syndrome and age.; Authors - Yi-Ting Wang
mouse	WB	iScience; Inhibition of cGAS-Mediated Interferon Response Facilitates Transgene Expression.; Authors - Yajuan Fu