RAE1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83712-4-RR (same clone as 83712-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83712-4-RR (RAE1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83712-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 83712-4-RR (same clone as 83712-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83712-4-RR (RAE1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83712-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83712-4-RR (same clone as 83712-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RAE1 antibody (83712-4-RR, Clone: 240861B7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83712-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83712-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83712-4-RR against Human RAE1 were performed. The affinity constant is 20.7 nM.

RAE1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83712-4-PBS

Clone No.240861B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

mRNA-associated protein mrnp 41, mRNA export factor RAE1, mRNA export factor, Mnrp41, MIG14

---

Product Information

83712-4-PBS targets RAE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12102

  Product name: Recombinant human RAE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC103754

  Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

• Full Name: RAE1 RNA export 1 homolog (S. pombe)
• Calculated Molecular Weight: 368 aa, 41 kDa
• GenBank Accession Number: BC103754
• Gene Symbol: RAE1
• Gene ID (NCBI): 8480
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P78406
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAE1 acts as a mRNA export factor involved in nucleocytoplasmic transport, it plays a role in mitotic bipolar spindle formation. (PMID: 33849972, MID: 17172455)