CoraLite® Plus 488-conjugated RAB1A Polyclonal antibody

• 

  IF Staining of NIH/3T3 using CL488-11671

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using CoraLite® Plus 488 RAB1A antibody (CL488-11671) at dilution of 1:400.

• Featured Product
• KD/KO Validated

RAB1A Polyclonal Antibody for IF/ICC

Cat No. CL488-11671

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

DKFZp564B163, RAB1, RAB1A, Ras related protein Rab 1A, YPT1, YPT1 related protein

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11671 targets RAB1A in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2264

  Product name: Recombinant human RAB1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC000905

  Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

• Full Name: RAB1A, member RAS oncogene family
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC000905
• Gene Symbol: RAB1A
• Gene ID (NCBI): 5861
• RRID: AB_3672504
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62820
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Rab1A is a member of the Rab family of small GTPases with a well characterized function in the regulation of vesicle trafficking from the endoplasmic reticulum to the Golgi apparatus and within Golgi compartments. Rab1A has recently been reported an mTORC1 activator and a colorectal oncogene (Janice D. Thomas. et al. 2014. Cancer cell).