Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RAB1A Polyclonal antibody

RAB1A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

EC:3.6.5.2, RAB1, Ras related protein Rab 1A, Ras-related protein Rab-1A, YPT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RAB1A in ?

Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, NIH/3T3 cells, U-251 cells, rat brain tissue, U2OS cells
Positive IP detected inA549 cells, C2C12 cells
Positive IHC detected inhuman lung cancer tissue, human liver tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells, NIH/3T3 cells, A549 cells
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11671-1-AP targets RAB1A in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2264

Product name: Recombinant human RAB1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-205 aa of BC000905

Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

Predict reactive species
Full Name RAB1A, member RAS oncogene family
Calculated Molecular Weight 205 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC000905
Gene Symbol RAB1A
Gene ID (NCBI) 5861
RRIDAB_2173437
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62820
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab1A is a member of the Rab family of small GTPases with a well characterized function in the regulation of vesicle trafficking from the endoplasmic reticulum to the Golgi apparatus and within Golgi compartments. Rab1A has recently been reported an mTORC1 activator and a colorectal oncogene (Janice D. Thomas. et al. 2014. Cancer cell). RAB1A may be cross-reactions with both RAB1B and RAB1C.

Protocols

Product Specific Protocols
FC protocol for RAB1A antibody 11671-1-APDownload protocol
IF protocol for RAB1A antibody 11671-1-APDownload protocol
IHC protocol for RAB1A antibody 11671-1-APDownload protocol
IP protocol for RAB1A antibody 11671-1-APDownload protocol
WB protocol for RAB1A antibody 11671-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Rab1A antibody (Cat# 11671-1-AP) has 27 citations published in journals including Cancer Cell, EMBO Journal, Cell Reports, Autophagy, Journal of Cell Biology, and Human Molecular Genetics. Research fields span cancer biology (colorectal, lung, breast, gastric, glioma), autophagy, mTOR signaling, neurodegeneration (Huntington's disease, ALS), glucose homeostasis, viral infection, and epithelial-mesenchymal transition.

SpeciesApplicationTitle
humanWB,IP

Cancer Cell

Rab1A Is an mTORC1 Activator and a Colorectal Oncogene.

Authors - Janice D Thomas
  • KD Validated
humanWB,IP,IF

Autophagy

RAB2 regulates the formation of autophagosome and autolysosome in mammalian cells.

Authors - Xianming Ding
  • KO Validated
humanWB,IHC,IF

Cancer Lett

Rab1A promotes IL-4R/JAK1/STAT6-dependent metastasis and determines JAK1 inhibitor sensitivity in non-small cell lung cancer.

Authors - Tinglei Huang
  • KD Validated
humanWB

Cell Commun Signal

Salmonella Typhimurium hijacks a host glucose transporter for intravacuolar proliferation.

Authors - Xianglan Fang
humanWB

JACS Au

Targeting GDP-Dissociation Inhibitor Beta (GDI2) with a Benzo[a]quinolizidine Library to Induce Paraptosis for Cancer Therapy

Authors - Yong Sun
humanWB

EMBO J

TOR-mediated Ypt1 phosphorylation regulates autophagy initiation complex assembly

Authors - Weijing Yao
  • KD Validated

Reviews

    4.6 out of 5
Add a review

3 verified customer reviews

What customers say

Users generally rate this antibody positively for Western Blot and Immunofluorescence. Two reviewers gave 5 stars, reporting clear bands at the expected molecular weight and good fluorescence signal with recommended dilutions. One reviewer noted a dirty background despite correct band recognition, giving 4 stars. Overall, the antibody performs well out of the box for most applications, though some users may need to optimize conditions to reduce background.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Victoria (Verified Customer) (10-09-2025)

Great antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293

Laura (Verified Customer) (08-15-2025)

Antibody worked great in WB and IF. Bands and fluorescence were expected. Dilutions as per data sheet. I totally recommend.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: Pancreatic beta cells

Boyan (Verified Customer) (02-22-2024)

recognized a band around the expected MW, but this antibody gave a dirty background.

  • Applications: Western Blot
Loading...
||
New chat

Able™

正在加载,请稍候...