CoraLite® Plus 488-conjugated Pericentrin Polyclonal antibody

• 

  IF Staining of HeLa using CL488-27084

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 Pericentrin antibody (CL488-27084) at dilution of 1:200.

Pericentrin Polyclonal Antibody for IF/ICC

Cat No. CL488-27084

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

KEN, Kendrin, KIAA0402, MOPD2, PCN, PCNT, PCNT2, PCNTB, PCTN2, pericentrin, Pericentrin B, SCKL4

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27084 targets Pericentrin in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25888

  Product name: Recombinant human PCNT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-200 aa of AK093923

  Sequence: MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI

• Full Name: pericentrin
• Calculated Molecular Weight: 378 kDa
• GenBank Accession Number: AK093923
• Gene Symbol: Pericentrin
• Gene ID (NCBI): 5116
• RRID: AB_3084106
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95613
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PCNT, also named as KIAA0402, PCNT2, Pericentrin-B and Kendrin, is an integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. PCNT plays a role, together with DISC1, in the microtubule network formation. PCNT is a marker of centrosome. Defects in PCNT are the cause of microcephalic osteodysplastic primordial dwarfism type 2 (MOPD2).