CoraLite® Plus 488-conjugated PLA2G1B Monoclonal antibody

• 

  WB analysis using CL488-66397

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66397 (PLA2G1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

PLA2G1B Monoclonal Antibody for WB

Cat No. CL488-66397

Clone No.1F2C10

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB

Synonyms

Group IB phospholipase A2, Phospholipase A2, PLA2, PLA2A, PLA2G1B, PPLA2

---

Tested Applications

• Positive WB detected in: pig pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66397 targets PLA2G1B in WB applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8812

  Product name: Recombinant human PLA2G1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-70 aa of BC005386

  Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV

• Full Name: phospholipase A2, group IB (pancreas)
• Calculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC005386
• Gene Symbol: PLA2G1B
• Gene ID (NCBI): 5319
• RRID: AB_3084243
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04054
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.