Tested Applications
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-20877 targets PKC Epsilon in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14976 Product name: Recombinant human PRKCE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 294-413 aa of BC109033 Sequence: VDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKV Predict reactive species |
Full Name | protein kinase C, epsilon |
Calculated Molecular Weight | 737 aa, 84 kDa |
Observed Molecular Weight | 84 kDa |
GenBank Accession Number | BC109033 |
Gene Symbol | PKC Epsilon |
Gene ID (NCBI) | 5581 |
RRID | AB_3084044 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q02156 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PKC Epsilon (Protein kinase C epsilon type) is also named as PKC-ε, PRKCE and PKCE. It belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family and PKC subfamily. PKC-ε, one of the novel isoforms, as a critical player in membrane mobilization during phagocytosis (PMID: 9069266). KC-ε is tethered to the Golgi through binding of its pseudosubstrate domain to phosphatidylinositol-4-phosphate (PI4P) (PMID: 28539432). PKC-ε traffics on microtubule-associated vesicles from the Golgi to the forming phagosome. As the majority of macrophage PKC-ε is cytosolic, and PKCs translocate from the cytosol to their sites of activity, it predicted that cytosolic PKC-ε concentrated at phagosomes to facilitate membrane addition (PMID: 34622926). Two PKC isozymes of the novel group, PKCε and PKCδ, have different and sometimes opposite effects. PKCε stimulates cell growth and differentiation while PKCδ is apoptotic (PMID: 21810427).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 PKC Epsilon antibody CL488-20877 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |