• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PKC Epsilon Polyclonal antibody

PKC Epsilon Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-20877

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

PRKCE, EC:2.7.11.13, nPKC-epsilon, PKCE, Protein kinase C epsilon type

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20877 targets PKC Epsilon in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14976

Product name: Recombinant human PRKCE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 294-413 aa of BC109033

Sequence: VDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKV

Predict reactive species
Full Name protein kinase C, epsilon
Calculated Molecular Weight 737 aa, 84 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC109033
Gene Symbol PKC Epsilon
Gene ID (NCBI) 5581
RRIDAB_3084044
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02156
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PKC Epsilon (Protein kinase C epsilon type) is also named as PKC-ε, PRKCE and PKCE. It belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family and PKC subfamily. PKC-ε, one of the novel isoforms, as a critical player in membrane mobilization during phagocytosis (PMID: 9069266). KC-ε is tethered to the Golgi through binding of its pseudosubstrate domain to phosphatidylinositol-4-phosphate (PI4P) (PMID: 28539432). PKC-ε traffics on microtubule-associated vesicles from the Golgi to the forming phagosome. As the majority of macrophage PKC-ε is cytosolic, and PKCs translocate from the cytosol to their sites of activity, it predicted that cytosolic PKC-ε concentrated at phagosomes to facilitate membrane addition (PMID: 34622926). Two PKC isozymes of the novel group, PKCε and PKCδ, have different and sometimes opposite effects. PKCε stimulates cell growth and differentiation while PKCδ is apoptotic (PMID: 21810427).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PKC Epsilon antibody CL488-20877Download protocol
IF protocol for CL Plus 488 PKC Epsilon antibody CL488-20877Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...