Tested Applications
| Positive IF/ICC detected in | HEK-293 cells | 
| Positive FC (Intra) detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-10495 targets PIN1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag0767 Product name: Recombinant human PIN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC002899 Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE Predict reactive species | 
                                    
| Full Name | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 
| Calculated Molecular Weight | 18 kDa | 
| Observed Molecular Weight | 18 kDa | 
| GenBank Accession Number | BC002899 | 
| Gene Symbol | PIN1 | 
| Gene ID (NCBI) | 5300 | 
| RRID | AB_3083881 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q13526 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
• PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PIN1 antibody CL488-10495 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



