Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PIN1 Polyclonal antibody

PIN1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

EC:5.2.1.8, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Pin 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PIN1 in ?

Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, PC-12 cells, mouse brain tissue, rat brain tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman renal cell carcinoma tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10495-1-AP targets PIN1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
RRIDAB_2163943
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13526
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

• PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Protocols

Product Specific Protocols
IF protocol for PIN1 antibody 10495-1-APDownload protocol
IHC protocol for PIN1 antibody 10495-1-APDownload protocol
IP protocol for PIN1 antibody 10495-1-APDownload protocol
WB protocol for PIN1 antibody 10495-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Pin1 antibody (Cat# 10495-1-AP) has 55 total citations published across journals including Nature Communications, Theranostics, Cell Death & Differentiation, Advanced Science, FASEB Journal, and International Journal of Molecular Sciences. Research fields span oncology (gastric, cervical, pancreatic, glioma, colorectal cancers), neurodegeneration (Alzheimer's, Parkinson's, epilepsy), inflammation and immunity, metabolic disorders, viral infections, fibrosis, and reproductive biology.

SpeciesApplicationTitle
humanWB,IP,IF

Nat Commun

Stabilization of Pin1 by USP34 promotes Ubc9 isomerization and protein sumoylation in glioma stem cells

Authors - Qiuhong Zhu
mouseWB

Metabolism

Prolyl isomerase Pin1 interacts with adipose triglyceride lipase and negatively controls both its expression and lipolysis.

Authors - Yusuke Nakatsu
  • KD Validated
humanWB

Nucleic Acids Res

Pin1 promotes GR transactivation by enhancing recruitment to target genes.

Authors - Poolman Toryn M TM
  • KD Validated
humanWB

Theranostics

SPTBN1 inhibits inflammatory responses and hepatocarcinogenesis via the stabilization of SOCS1 and downregulation of p65 in hepatocellular carcinoma.

Authors - Ling Lin
mouseWB

Adv Sci (Weinh)

CpG-Based Nanovaccines Enhance Ovarian Cancer Immune Response by Gbp2-Mediated Remodeling of Tumor-Associated Macrophages

Authors - Jiaqiang Xiong
mouse,humanWB,IP,IHC

Cell Death Differ

PIN1 and CDK1 cooperatively govern pVHL stability and suppressive functions

Authors - Jiayi Chen
  • KD Validated

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user review was found for this product. Carly Garrison (November 2020) rated it 3 out of 5 stars and noted that they tested the antibody using EDTA plasma on an antibody microarray. No additional details on performance or issues were provided in the review.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able™

正在加载,请稍候...