• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated NLRX1 Polyclonal antibody

NLRX1 Polyclonal Antibody for IF/ICC
Cat No. CL594-17215

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Nucleotide-binding oligomerization domain protein 9, Nucleotide-binding oligomerization domain protein 5, NOD9, NOD5, NLRX 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, A549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-17215 targets NLRX1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11000

Product name: Recombinant human NLRX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 359-708 aa of BC013199

Sequence: EAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTEAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLQGVAIQMCWKLPLLPYAHLWTPRMPSHWCFLLILMPPLPQWYDGLVAPRGRCT

Predict reactive species
Full Name NLR family member X1
Calculated Molecular Weight 975 aa, 108 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC013199
Gene Symbol NLRX1
Gene ID (NCBI) 79671
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86UT6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NLRX1 (Nucleotide-binding oligomerization domain, leucine-rich repeat containing X1) is a member of the NOD-like receptor (NLR) family and is unique among NLRs due to its localization to the mitochondrial matrix. NLRX1 is a negative regulator of innate immunity, particularly in viral infections. It interacts with the mitochondrial antiviral signaling protein (MAVS) to attenuate antiviral responses. NLRX1 has been implicated in various diseases, including multiple sclerosis, colorectal cancer, and ischemia-reperfusion injury. Its role in controlling inflammation and mitochondrial function makes it a potential therapeutic target.

Protocols

Product Specific Protocols
IF protocol for CL594 NLRX1 antibody CL594-17215Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...