Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated N-cadherin Polyclonal antibody

N-cadherin Polyclonal Antibody for IF-P

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Cadherin 2, CD325, CDH2, CDHN, CDw325, N cadherin, NCAD, N-cadherin, Neural cadherin

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for N-cadherin in ?

Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22018 targets N-cadherin in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16792

Product name: Recombinant human N-cadherin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 421-535 aa of BC036470

Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT

Predict reactive species
Full Name cadherin 2, type 1, N-cadherin (neuronal)
Calculated Molecular Weight 906 aa, 100 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC036470
Gene Symbol N-cadherin
Gene ID (NCBI) 1000
RRIDAB_2919190
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19022
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuronal cadherin (N-cadherin), also known as cadherin-2 (CDH2), is a calcium-binding protein that mediates cell-cell adhesions of neuronal and some non-neuronal cell types. 

What is the molecular weight of N-cadherin? Is N-cadherin post-translationally modified?

The molecular weight of mature N-cadherin is 127 kDa. N-cadherin is synthesized in a precursor form that undergoes proteolytic cleavage by furin at the Golgi apparatus. Additionally, it can be phosphorylated by casein kinase II and N-glycosylated, which affects its stability (PMID: 12604612 and 19846557). 

What is the subcellular localization of N-cadherin? What is the tissue expression pattern of N-cadherin?

N-cadherin is an integral membrane protein present at the plasma membrane, forming adherens junctions. It is widely expressed in the nervous system, where it flanks the active zone of synapses and is important for synapse formation and remodeling. It is also present in the lens, skeletal, and cardiac muscles (PMID: 3857614). In the muscle, N-cadherin plays a role in myoblast differentiation, while in the heart it is required for the formation of intercalated discs. Additionally, N-cadherin is present in blood vessels, promoting angiogenesis by forming adhesive complexes between endothelial cells and pericytes (PMID: 24521477). 

What is the role of N-cadherin during the epithelial-mesenchymal transition (EMT)?

EMT is a crucial process during gastrulation that leads to the formation of mesenchymal cells. It is marked by decreased expression of E-cadherin and upregulation of N-cadherin, which promotes cell migration (PMID: 23481201). Similarly, upregulation of N-cadherin is observed in many cancer cell types and is associated with increased invasiveness and metastasis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 N-cadherin antibody CL488-22018Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The N-cadherin Polyclonal antibody (catalog no. CL488-22018, CoraLite® Plus 488 conjugate) has 1 citation. It was used in a study published in iScience (IF 4.5) investigating how MZT2A drives epithelial-mesenchymal transition in lung adenocarcinoma via the LGALS3BP/ITGB1/TGF-β/smad2 axis. The application was Western blot in human samples. The research field is cancer biology, specifically EMT and lung adenocarcinoma.

SpeciesApplicationTitle
humanWB

iScience

MZT2A drives epithelial-mesenchymal transition in lung adenocarcinoma via the LGALS3BP/ITGB1/TGF-β/smad2 axis.

Authors - Yizhuo Li
Loading...
||
New chat

Able™

正在加载,请稍候...