CoraLite® Plus 488-conjugated MMP13 Polyclonal antibody

• 

  IF Staining of MCF-7 using CL488-18165

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 MMP13 antibody (CL488-18165) at dilution of 1:200.

• Featured Product
• KD/KO Validated

MMP13 Polyclonal Antibody for IF/ICC

Cat No. CL488-18165

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

MMP 13, Matrix metalloproteinase-13, Matrix metalloproteinase 13, EC:3.4.24.-, Collagenase 3

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-18165 targets MMP13 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12653

  Product name: Recombinant human MMP13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-471 aa of BC074808

  Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

• Full Name: matrix metallopeptidase 13
• Calculated Molecular Weight: 471 aa, 54 kDa
• Observed Molecular Weight: 65-70 kDa, 50-55 kDa, 40 kDa
• GenBank Accession Number: BC074808
• Gene Symbol: MMP13
• Gene ID (NCBI): 4322
• RRID: AB_3672691
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45452
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated preform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).