MMP13 Polyclonal antibody

• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 18165-1-AP

  IP result of anti-MMP13 (IP:18165-1-AP, 4ug; Detection:18165-1-AP 1:300) with MCF-7 cells lysate 2480 ug.

• 

  IHC staining of human liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of MCF-7 using 18165-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using MMP13 antibody (18165-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

The mmp13 polyclonal antibody (18165-1-AP) is one of the most highly cited mmp13 antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 607 publications.

Cat No. 18165-1-AP

Publications(607)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13, Matrix metalloproteinase-13

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-453s cells, mouse liver tissue, rat liver tissue, HepG2 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue, mouse liver tissue, human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 431 publications below
• IHC: See 232 publications below
• IF: See 167 publications below
• CoIP: See 1 publications below

Product Information

18165-1-AP targets MMP13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, zebrafish, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12653

  Product name: Recombinant human MMP13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-471 aa of BC074808

  Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

• Full Name: matrix metallopeptidase 13
• Calculated Molecular Weight: 471 aa, 54 kDa
• Observed Molecular Weight: 65-70 kDa, 50-55 kDa, 40 kDa
• GenBank Accession Number: BC074808
• Gene Symbol: MMP13
• Gene ID (NCBI): 4322
• RRID: AB_2144858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated proform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF	Nature; A plant-derived natural photosynthetic system for improving cell anabolism; Authors - Pengfei Chen
human	IF	Cell Stem Cell; A human organoid drug screen identifies α2-adrenergic receptor signaling as a therapeutic target for cartilage regeneration; Authors - Xiaocui Wei
rat	IF	Bioact Mater; Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair; Authors - Changjian Lin
mouse,human	WB,IF	Sci Transl Med; Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology; Authors - Su'an Tang
mouse	WB	Nat Commun; Osteocyte-derived extracellular vesicles mediate the bone-to-cartilage crosstalk and promote osteoarthritis progression; Authors - Na Liu
mouse,human	WB,IF	Adv Sci (Weinh); Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis; Authors - Bin Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xie (Verified Customer) (05-13-2021)

Good IHC staining for Rat MMP13.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: rat knee joints

MMP13 Antibody Immunohistochemistry validation (1:100 dilution) in rat knee joints (Cat no:18165-1-AP)

FH

Hongxue (Verified Customer) (01-12-2021)

clear wb band

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Liver

MMP13 Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:18165-1-AP)