MMP13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MMP13 Polyclonal antibody (18165-1-AP)

• Featured Product
• KD/KO Validated

The mmp13 polyclonal antibody (18165-1-AP) is one of the most highly cited mmp13 antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 840 publications.

Cat No. 18165-1-AP

Publications(840)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13, Matrix metalloproteinase-13

• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18165-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 18165-1-AP

  IP result of anti-MMP13 (IP:18165-1-AP, 4ug; Detection:18165-1-AP 1:300) with MCF-7 cells lysate 2480 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18165-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 18165-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using MMP13 antibody (18165-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-453s cells, mouse liver tissue, rat liver tissue, HepG2 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue, mouse liver tissue, human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18165-1-AP targets MMP13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, zebrafish, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12653

  Product name: Recombinant human MMP13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-471 aa of BC074808

  Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

• Full Name: matrix metallopeptidase 13
• Calculated Molecular Weight: 471 aa, 54 kDa
• Observed Molecular Weight: 65-70 kDa, 50-55 kDa, 40 kDa
• GenBank Accession Number: BC074808
• Gene Symbol: MMP13
• Gene ID (NCBI): 4322
• RRID: AB_2144858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated proform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; WSTF nuclear autophagy regulates chronic but not acute inflammation; Authors - Yu Wang
mouse,human	IF	Nature; A plant-derived natural photosynthetic system for improving cell anabolism; Authors - Pengfei Chen
mouse	IF	Nat Nanotechnol; A disease-severity-responsive nanoparticle enables potent ghrelin messenger RNA therapy in osteoarthritis.; Authors - Mahima Dewani
mouse	IHC	Cell Metab; Semaglutide ameliorates osteoarthritis progression through a weight loss-independent metabolic restoration mechanism.; Authors - Hongyu Qin
mouse	IF	Immunity; A bladder-blood immune barrier constituted by suburothelial perivascular macrophages restrains uropathogen dissemination; Authors - Lu Li
		Exploration (Beijing); Matching TGF-β1 Activation With Stress-Responsive Charge-Reversal Hydrogel Microspheres for the Treatment of Osteoarthritis.; Authors - Feng Lin

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Xie (Verified Customer) (05-13-2021)

Good IHC staining for Rat MMP13.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: rat knee joints

MMP13 Antibody Immunohistochemistry validation (1:100 dilution) in rat knee joints (Cat no:18165-1-AP)

Hongxue (Verified Customer) (01-12-2021)

clear wb band

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Liver

MMP13 Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:18165-1-AP)