MLPH Recombinant monoclonal antibody

• 

  WB analysis using 84282-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84282-1-RR (MLPH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 84282-1-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84282-1-RR (MLPH antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 84282-1-RR

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84282-1-RR (MLPH antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84282-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84282-1-RR against Human MLPH were performed. The affinity constant is 2.43 nM.

MLPH Recombinant Antibody for WB, IHC, ELISA

Cat No. 84282-1-RR

Clone No.241621G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

SLAC2A, SLAC2 A, Melanophilin, Exophilin-3, Exophilin 3

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, MCF-7 cells, PC-3 cells, HT-29 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84282-1-RR targets MLPH in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32931

  Product name: Recombinant human MLPH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 372-600 aa of BC001653

  Sequence: AGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS

• Full Name: melanophilin
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa, 80 kDa
• GenBank Accession Number: BC001653
• Gene Symbol: MLPH
• Gene ID (NCBI): 79083
• RRID: AB_3671828
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BV36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Melanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft.