MERTK Recombinant monoclonal antibody

• 

  WB analysis using 84156-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84156-2-RR (MERTK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 84156-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84156-2-RR (MERTK antibody) at dilution of 1:250 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of Jurkat using 84156-2-RR

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug MERTK Recombinant antibody (84156-2-RR, Clone:241252H3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84156-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84156-2-RR against Human MERTK were performed. The affinity constant is 0.444 nM.

MERTK Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 84156-2-RR

Clone No.241252H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

241252H3, c mer, EC:2.7.10.1, MER, Proto oncogene c Mer

---

Tested Applications

• Positive WB detected in: U-937 cells, HEK-293T cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84156-2-RR targets MERTK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27540

  Product name: Recombinant human MERTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 829-999 aa of BC114918

  Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

• Full Name: c-mer proto-oncogene tyrosine kinase
• Calculated Molecular Weight: 999 aa, 110 kDa
• Observed Molecular Weight: 160-180 kDa
• GenBank Accession Number: BC114918
• Gene Symbol: MERTK
• Gene ID (NCBI): 10461
• RRID: AB_3671721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12866
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).