MERTK Recombinant monoclonal antibody, PBS Only (Capture)

MERTK Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 84156-2-PBS
Clone No.241252H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

241252H3, c mer, EC:2.7.10.1, MER, Proto oncogene c Mer

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84156-2-PBS targets MERTK as part of a matched antibody pair:

MP01061-2: 84156-2-PBS capture and 84156-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27540

Product name: Recombinant human MERTK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 829-999 aa of BC114918

Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

Predict reactive species
Full Name c-mer proto-oncogene tyrosine kinase
Calculated Molecular Weight 999 aa, 110 kDa
Observed Molecular Weight160-180 kDa
GenBank Accession NumberBC114918
Gene Symbol MERTK
Gene ID (NCBI) 10461
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12866
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477).

Loading...
||
New chat Able
正在加载,请稍候...