Tested Applications
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue, mouse brain tissue, rat cerebellum tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | rat brain tissue, mouse brain tissue |
| Positive FC (Intra) detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67015-1-Ig targets MAP2 in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11349 Product name: Recombinant human MAP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species |
| Full Name | microtubule-associated protein 2 |
| Calculated Molecular Weight | 200 kDa |
| GenBank Accession Number | BC038857 |
| Gene Symbol | MAP2 |
| Gene ID (NCBI) | 4133 |
| RRID | AB_2882331 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P11137 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in brain and has important role in neuronal morphogenesis. Multiple high molecular weight (MW) and low molecular weight (MW) MAP2 isoforms are expressed within axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally specific manner. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MAP2 antibody 67015-1-Ig | Download protocol |
| IF protocol for MAP2 antibody 67015-1-Ig | Download protocol |
| IHC protocol for MAP2 antibody 67015-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
MAP2 Monoclonal antibody (1C3E6), catalog number 67015-1-Ig, has 79 citations. These appear in high-impact journals including Cell, Nature Materials, Nature Communications, Cell Metabolism, Cell Stem Cell, Advanced Science, Autophagy, and EMBO Molecular Medicine, among over 50 others. Research fields span neuroscience and neurodegeneration (Alzheimer's disease, Parkinson's disease), spinal cord injury repair, ischemic stroke, neuroinflammation, neural stem cell biology, cognitive impairment, and neuronal differentiation.
| Species | Application | Title |
|---|---|---|
Cell Metab Oral GLP-1 receptor agonist promotes astrocyte-neuron lactate and lipid transfer with neuroprotective effects. | ||
Cell Stem Cell In vivo reprogramming of NG2 glia enables adult neurogenesis and functional recovery following spinal cord injury. | ||
Autophagy FGF21 rejuvenates aged human adipose-derived mesenchymal stem cells via enhancement of TFE3-mediated autophagy flux. | ||
Nat Commun DISC1 Protects Against Zika Virus Infection and Long-Term Neurological Damage Through AMPK-mTOR-Mediated Autophagy |
Reviews
What customers say
All five reviews are 5-star. Users report consistent performance across immunofluorescence, Western blot, immunohistochemistry, and ICC on a range of samples including primary mouse neurons, mouse brain, cortical organoids, and human primary cortical cells. Typical dilutions are 1/800–1/1/1000. Reviewers highlight clean specificity with no unspecific staining and reliable results overall.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Baptiste (Verified Customer) (06-08-2026) | Good results on primary mouse neurons.
|
Marion (Verified Customer) (03-11-2025) | Very good product
![]() |
Marianne (Verified Customer) (11-24-2024) | good
|
Alessandro (Verified Customer) (12-09-2023) | good IF antibody. no unspecific staining
|
Azita (Verified Customer) (05-31-2021) | Human primary cortical cells went trough ICC and the MAP2 antibody at the 1/1000 dilution was used overnight at 4°C.
![]() |

















































