CoraLite® Plus 488-conjugated MAP2 Monoclonal antibody

MAP2 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-67015
Clone No.1C3E6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

1C3E6, MAP 2, MAP-2, MAP2A, MAP2B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inrat brain tissue
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67015 targets MAP2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11349

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
RRIDAB_2934512
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11137
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in brain and has important role in neuronal morphogenesis. Multiple high molecular weight (MW) and low molecular weight (MW) MAP2 isoforms are expressed within axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally specific manner. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MAP2 antibody CL488-67015Download protocol
IF protocol for CL Plus 488 MAP2 antibody CL488-67015Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...