LY6E Polyclonal antibody, PBS Only

• 

  WB analysis using 22144-1-AP (same clone as 22144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22144-1-AP (LY6E antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22144-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LY6E Polyclonal Antibody for WB, ELISA

Cat No. 22144-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

9804, Ly 6E, Ly-6E, Retinoic acid-induced gene E protein, RIGE

---

Product Information

22144-1-PBS targets LY6E in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17573

  Product name: Recombinant human LY6E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-101 aa of BC119708

  Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

• Full Name: lymphocyte antigen 6 complex, locus E
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 12-16 kDa
• GenBank Accession Number: BC119708
• Gene Symbol: LY6E
• Gene ID (NCBI): 4061
• RRID: AB_2879007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16553
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The predicted MW of LY6E is 13 kDa. Catalog#22144-1-AP recognises two band of 13 kDa and 18 kDa, and the additional 18 kDa band may be due to glycosylation.