L1TD1 Polyclonal antibody, PBS Only

• 

  WB analysis of NCCIT cells using 21528-1-AP (same clone as 21528-1-PBS)

  WB result of L1TD1 antibody (21528-1-AP, 1:500) with NCCIT cells. This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21528-1-AP (L1TD1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21528-1-AP (L1TD1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 21528-1-AP (L1TD1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 21528-1-AP (L1TD1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21528-1-AP (L1TD1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 21528-1-AP (same clone as 21528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21528-1-AP (L1TD1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NCCIT using 21528-1-AP (same clone as 21528-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NCCIT cells using L1TD1 antibody (21528-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 21528-1-PBS in a different storage buffer formulation.

L1TD1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21528-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

LINE-1 type transposase domain-containing protein 1, ES cell-associated protein 11, ES cell associated protein 11, ECAT11

---

Product Information

21528-1-PBS targets L1TD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16147

  Product name: Recombinant human L1TD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 522-865 aa of BC111559

  Sequence: KLVKHQVVHKTQEEEETAVPTSQGTGTPCLTLCLASPSKSLEMSHDEHKKHSHTNLSISTGVTKLKKTEEKKHRTLHTEELTSKEADLTEETEENLRSSVINSIREIKEEIGNLKSSHSGVLEIENSVDDLSSRMDILEERIDSLEDQIEEFSKDTMQMTKQIISKERQRDIEERSRSCNIRLIGIPEKESYENRAEDIIKEIIDENFAELKKGSSLEIVSACRVPSKIDEKRLTPRHILVKFWNSSDKEKIIRASRERREITYQGTRIRLTADLSLDTLDARSKWSNVFKVLLEKGFNPRILYPAKMAFDFRGKTKVFLSIEEFRDYVLHMPTLRELLGNNIP

• Full Name: LINE-1 type transposase domain containing 1
• Calculated Molecular Weight: 865 aa, 99 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC111559
• Gene Symbol: L1TD1
• Gene ID (NCBI): 54596
• RRID: AB_2878878
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T7N2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

L1TD1 is an RNA-binding protein highly and specifically expressed in pluripotent cells. It is essential for maintaining the pluripotentency in human embryonic stem cells (hESCs) and has been considered as a marker for undifferentiated hESCs. L1TD1 is also reported to be highly expressed in medulloblastoma cells and its expression in medulloblastoma correlates with poor clinical outcome.