CoraLite® Plus 488-conjugated KLF4 Polyclonal antibody

• 

  FC experiment of HeLa using CL488-11880

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human KLF4 (CL488-11880) (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

KLF4 Polyclonal Antibody for FC (Intra)

Cat No. CL488-11880

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

Krueppel-like factor 4, Krueppel like factor 4, GKLF, EZF

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11880 targets KLF4 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2480

  Product name: Recombinant human KLF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-504 aa of BC030811

  Sequence: IPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

• Full Name: Kruppel-like factor 4 (gut)
• Calculated Molecular Weight: 504 aa, 54 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC030811
• Gene Symbol: KLF4
• Gene ID (NCBI): 9314
• RRID: AB_3083910
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43474
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The mammalian Krüppel-like transcription factor 4 (Klf4) is an evolutionarily conserved zinc finger-containing transcription factor with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. It also plays a significant role in the process of tumorigenesis. Klf4 is one of the key transcription factors that have been used to reprogram mouse and human fibroblasts to a pluripotent state also called induced pluripotent stem (iPS) cells. Affinity purified rabbit anti- Klf4 is for the detection of Klf4 transgene expression in the process of reprogramming. There are two isoforms of KLF4 (PMID: 15561714), with MW range from 50 to 60 kDa,and major band is 55 kDa. KLF4 protein can be ubiquitin modified.