CoraLite® Plus 488-conjugated INPP5E Recombinant monoclonal antibody

INPP5E Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82689-3
Clone No.1E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

72 kDa inositol polyphosphate 5-phosphatase, EC:3.1.3.36, EC:3.1.3.86, Inositol polyphosphate-5-phosphatase E, Phosphatidylinositol 4,5-bisphosphate 5-phosphatase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inhTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82689-3 targets INPP5E in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30305

Product name: Recombinant human INPP5E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 184-350 aa of BC028032

Sequence: RLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET

Predict reactive species
Full Name inositol polyphosphate-5-phosphatase, 72 kDa
Calculated Molecular Weight 644 aa, 70 kDa
Observed Molecular Weight 64-66 kDa
GenBank Accession NumberBC028032
Gene Symbol INPP5E
Gene ID (NCBI) 56623
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRR6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

INPP5E(72 kDa inositol polyphosphate 5-phosphatase) converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2.In mouse, highest protein expression was in brain, heart, and testis, with lower expression in thymus and lung, and very little expression in kidney, spleen, and liver(PMID:10764818). Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1) and mental retardation-truncal obesity-retinal dystrophy-micropenis (MORMS)(PMID:19668215). It has 2 isoforms with the molecular mass of 66 kDa and 70 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 INPP5E antibody CL488-82689-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...