INPP5E Recombinant monoclonal antibody

• 

  IF Staining of hTERT-RPE1 using 82689-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Starvation treated hTERT-RPE1 cells using INPP5E antibody (82689-3-RR, Clone: 1E7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), Acetyl-Tubulin (Lys40) antibody (66200-1-Ig, Clone: 7E5H8, red).

• 

  IF Staining of hTERT-RPE1 using 82689-3-RR

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using INPP5E antibody (82689-3-RR, Clone: 1E7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Acetyl-Tubulin (Lys40) antibody (66200-1-Ig, Clone: 7E5H8, red).

• 

  Affinity and Kinetic Characterization of 82689-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82689-3-RR against Human INPP5E were performed. The affinity constant is 0.166 nM.

INPP5E Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 82689-3-RR

Clone No.1E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

1E7, 72 kDa inositol polyphosphate 5-phosphatase, EC:3.1.3.36, EC:3.1.3.86, Inositol polyphosphate-5-phosphatase E

---

Tested Applications

• Positive IF/ICC detected in: Starvation treated hTERT-RPE1 cells, hTERT-RPE1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82689-3-RR targets INPP5E in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30305

  Product name: Recombinant human INPP5E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-350 aa of BC028032

  Sequence: RLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET

• Full Name: inositol polyphosphate-5-phosphatase, 72 kDa
• Calculated Molecular Weight: 644 aa, 70 kDa
• Observed Molecular Weight: 64-66 kDa
• GenBank Accession Number: BC028032
• Gene Symbol: INPP5E
• Gene ID (NCBI): 56623
• RRID: AB_3670528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRR6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INPP5E(72 kDa inositol polyphosphate 5-phosphatase) converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2.In mouse, highest protein expression was in brain, heart, and testis, with lower expression in thymus and lung, and very little expression in kidney, spleen, and liver(PMID:10764818). Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1) and mental retardation-truncal obesity-retinal dystrophy-micropenis (MORMS)(PMID:19668215). It has 2 isoforms with the molecular mass of 66 kDa and 70 kDa.