Human IgA Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Human IgA Monoclonal antibody (60099-1-Ig)

Human IgA Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60099-1-Ig Copied!

Clone No. 3A5A5

Publications (13)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (3)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Human IgA Heavy Chain, IGHA1, 3A5A5, IgA, IgA1

• 

  WB analysis of human saliva using 60099-1-Ig

  human saliva were subjected to SDS PAGE followed by western blot with 60099-1-Ig (Human IgA Antibody) at dilution of 1:16000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 60099-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 60099-1-Ig (Human IgA Antibody) at dilution of 1:64000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 60099-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60099-1-Ig (Human IgA antibody) at dilution of 1:320000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 60099-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60099-1-Ig (Human IgA antibody) at dilution of 1:320000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 60099-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60099-1-Ig (Human IgA antibody) at dilution of 1:320000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 60099-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60099-1-Ig (Human IgA antibody) at dilution of 1:50000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 60099-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using Human IgA antibody (60099-1-Ig, Clone: 3A5A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Human IgA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human saliva tissue, human saliva, human plasma
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:160000-1:640000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60099-1-Ig targets Human IgA in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7417

  Product name: Recombinant human IgA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 4-353 aa of BC016369

  Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

• Full Name: Human IgA
• Calculated Molecular Weight: 496 aa, 53 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC016369
• RRID: AB_1557448
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Publications

What published studies show

Human IgA Monoclonal antibody (3A5A5), catalog number 60099-1-Ig, has 13 citations across 12 journals including Nature Communications, J Nanobiotechnology, Advanced Science, EBioMedicine, EMBO Molecular Medicine, Kidney International Reports, Hepatology Communications, European Journal of Pharmacology, International Immunopharmacology, Annals of Surgical Oncology, Porcine Health Management, and Immunology Research. Research fields span IgA nephropathy, tumor immunology, vaccine development, intestinal immunity, and drug delivery.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Sterically chained amino acid-rich water-soluble carbon quantum dots as a robust tumor-targeted drug delivery platform; Authors - Wenjing Xie
		J Nanobiotechnology; A milk-based self-assemble rotavirus VP6-ferritin nanoparticle vaccine elicited protection against the viral infection.; Authors - Zhipeng Li
		J Nanobiotechnology; Biomimetic phosphorus dendrimer multi-epitope nanovaccine enhances humoral and cellular immune response against African swine fever virus; Authors - Hong Duan
		Adv Sci (Weinh); Continuous Oral Administration of the Superantigen Staphylococcal Enterotoxin C2 Activates Intestinal Immunity and Modulates the Gut Microbiota in Mice; Authors - Wu Gu
human	IHC,IF	EBioMedicine; Mature tertiary lymphoid structures support B cell-mediated antitumour immunity and are disrupted by neoadjuvant therapy in rectal cancer: a multicentre, retrospective study.; Authors - Na Tian
human	IF	EMBO Mol Med; A skin colonizer disrupts inflammatory and humoral immune defenses in hidradenitis suppurativa.; Authors - Viviane A Agbogan