Human IgA Monoclonal antibody

Human IgA Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 60099-1-Ig
Clone No.3A5A5

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

Human IgA Heavy Chain, IGHA1, 3A5A5, IgA, IgA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman saliva tissue, human saliva, human plasma
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:160000-1:640000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60099-1-Ig targets Human IgA in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7417

Product name: Recombinant human IgA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 4-353 aa of BC016369

Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

Predict reactive species
Full Name immunoglobulin heavy constant alpha 1
Calculated Molecular Weight 496 aa, 53 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC016369
Gene Symbol Human IgA Heavy Chain
Gene ID (NCBI) 3493
RRIDAB_1557448
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Protocols

Product Specific Protocols
IF protocol for Human IgA antibody 60099-1-IgDownload protocol
IHC protocol for Human IgA antibody 60099-1-IgDownload protocol
WB protocol for Human IgA antibody 60099-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

J Nanobiotechnology

Biomimetic phosphorus dendrimer multi-epitope nanovaccine enhances humoral and cellular immune response against African swine fever virus

Authors - Hong Duan
humanIF

Kidney Int Rep

Carboxymethyl-lysine is a Prominent Target of Circulating IgA in IgA Nephropathy

Authors - Sara Alibrandi

Adv Sci (Weinh)

Continuous Oral Administration of the Superantigen Staphylococcal Enterotoxin C2 Activates Intestinal Immunity and Modulates the Gut Microbiota in Mice

Authors - Wu Gu
ratIF

Eur J Pharmacol

Inhibition of excessive autophagy alleviates renal injury and inflammation in a rat model of immunoglobulin A nephropathy

Authors - Meiying Chang

J Nanobiotechnology

A milk-based self-assemble rotavirus VP6-ferritin nanoparticle vaccine elicited protection against the viral infection.

Authors - Zhipeng Li
mouseWB

Nat Commun

Sterically chained amino acid-rich water-soluble carbon quantum dots as a robust tumor-targeted drug delivery platform

Authors - Wenjing Xie
Loading...
||
New chat Able
正在加载,请稍候...