• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IFT88 Polyclonal antibody

IFT88 Polyclonal Antibody for IF/ICC
Cat No. CL488-13967

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, Canine

Applications

IF/ICC

D13S1056E, DAF19, hTg737, IFT88, RP11 172H24.2, TG737, TPR repeat protein 10, TTC10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inC2C12 cells, MDCK cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13967 targets IFT88 in IF/ICC applications and shows reactivity with human, mouse, rat, Canine samples.

Tested Reactivity human, mouse, rat, Canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4980

Product name: Recombinant human IFT88 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 532-833 aa of BC030776

Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE

Predict reactive species
Full Name intraflagellar transport 88 homolog (Chlamydomonas)
Calculated Molecular Weight 94 kDa
Observed Molecular Weight 88-95 kDa
GenBank Accession NumberBC030776
Gene Symbol IFT88
Gene ID (NCBI) 8100
RRIDAB_2919083
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13099
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IFT88 antibody CL488-13967Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...