Tested Applications
| Positive IF/ICC detected in | K-562 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-60074 targets IFITM1-Specific in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species | 
                                    
| Full Name | interferon induced transmembrane protein 1 (9-27) | 
| Calculated Molecular Weight | 14 kDa | 
| Observed Molecular Weight | 14 kDa, 17 kDa | 
| GenBank Accession Number | BC000897 | 
| Gene Symbol | IFITM1 | 
| Gene ID (NCBI) | 8519 | 
| RRID | AB_2919229 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P13164 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 IFITM1-Specific antibody CL488-60074 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

