IFITM1-Specific Monoclonal antibody, PBS Only

• 

  WB analysis using 60074-1-Ig (same clone as 60074-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60074-1-Ig (IFITM1-Specific antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of TF-1 using 60074-1-Ig (same clone as 60074-1-PBS)

  TF-1 cells were subjected to SDS PAGE followed by western blot with 60074-1-Ig (IFITM1-Specific antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 60074-1-Ig (same clone as 60074-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 60074-1-Ig (IFITM1-Specific Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 60074-1-Ig (same clone as 60074-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 60074-1-Ig (IFITM1-Specific Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 60074-1-Ig (same clone as 60074-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 60074-1-Ig (IFITM1-Specific antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 60074-1-Ig (same clone as 60074-1-PBS)

  IP result of anti-IFITM1-Specific (IP:60074-1-Ig, 4ug; Detection:60074-1-Ig 1:500) with HepG2 cells lysate 3600ug. This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 60074-1-Ig (same clone as 60074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60074-1-Ig (IFITM1-Specific Antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 60074-1-Ig (same clone as 60074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60074-1-Ig (IFITM1-Specific Antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 60074-1-Ig (same clone as 60074-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using IFITM1-Specific antibody (60074-1-Ig, Clone: 5B5E2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 60074-1-Ig (same clone as 60074-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using IFITM1-Specific antibody (60074-1-Ig, Clone: 5B5E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60074-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IFITM1-Specific Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60074-1-PBS

Clone No.5B5E2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

IFITM1, 5B5E2, 9 27, 927, CD225

---

Product Information

60074-1-PBS targets IFITM1-Specific in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2320

  Product name: Recombinant human IFITM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC000897

  Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

• Full Name: interferon induced transmembrane protein 1 (9-27)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC000897
• Gene Symbol: IFITM1
• Gene ID (NCBI): 8519
• RRID: AB_2233405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.