• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Histone H4 Polyclonal antibody

Histone H4 Polyclonal Antibody for FC (Intra)
Cat No. CL488-16047

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

H4, HIST1H4E, H4C1, H4C2, H4C3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.8 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16047 targets Histone H4 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8999

Product name: Recombinant human Histone H4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC012587

Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Predict reactive species
Full Name histone cluster 1, H4e
Calculated Molecular Weight 102 aa, 11 kDa
Observed Molecular Weight 14 kDa, 11 kDa
GenBank Accession NumberBC012587
Gene Symbol Histone H4
Gene ID (NCBI) 8367
RRIDAB_3083984
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62805
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Histone H4 is a 103 amino acid protein, which belongs to the histone H4 family. Histone H4 localizes in the nucleus and is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Histone H4 antibody CL488-16047Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...