Tested Applications
| Positive IF-P detected in | mouse pancreas tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below | 
Product Information
CL488-67286 targets Glucagon in IF-P applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse | 
| Cited Reactivity | mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10629 Product name: Recombinant human Glucagon protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-180 aa of BC005278 Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK Predict reactive species | 
                                    
| Full Name | glucagon | 
| Calculated Molecular Weight | 180 aa, 21 kDa | 
| GenBank Accession Number | BC005278 | 
| Gene Symbol | Glucagon | 
| Gene ID (NCBI) | 2641 | 
| RRID | AB_2883402 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P01275 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Glucagon is a 29-amino acid peptide hormone secreted from the pancreatic alpha cells with a powerful stimulatory effect on hepatic glucose production acting to increase plasma glucose levels. Glucagon is best known as the counter-regulatory hormone to INS, and normal glucose homeostasis depends largely on the balanced secretion of INS and glucagon fromthe pancreatic beta and alpha cells, respectively.The regulation of glucose metabolism by glucagon is mediated by its direct action on the peripheral tissues such as the liver and also by the brain. Glucagon is also released postprandially in a transient manner, which was shown to be involved in inhibition of food intake via reduction of meal size.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Glucagon antibody CL488-67286 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

