Tested Applications
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-67329 targets GSK3B in FC (Intra) applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Full Name | glycogen synthase kinase 3 beta |
| Calculated Molecular Weight | 433 aa, 48 kDa |
| Observed Molecular Weight | 46-48 kDa |
| GenBank Accession Number | BC000251 |
| Gene Symbol | GSK3B |
| Gene ID (NCBI) | 2932 |
| RRID | AB_2935077 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P49841 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase .GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution .
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 647 GSK3B antibody CL647-67329 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

