GOSR2/Membrin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84962-4-RR (same clone as 84962-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84962-4-RR (GOSR2/Membrin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84962-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84962-4-RR (same clone as 84962-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOSR2/Membrin antibody (84962-4-RR, Clone: 242589D8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84962-4-PBS in a different storage buffer formulation.

GOSR2/Membrin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84962-4-PBS

Clone No.242589D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Membrin, GS27, GOSR2, Golgi SNAP receptor complex member 2, 27 kDa Golgi SNARE protein

---

Product Information

84962-4-PBS targets GOSR2/Membrin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2736

  Product name: Recombinant human GOSR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC009710

  Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF

• Full Name: golgi SNAP receptor complex member 2
• Calculated Molecular Weight: 212 aa, 25 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC009710
• Gene Symbol: Membrin
• Gene ID (NCBI): 9570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14653
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the soluble NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in the Golgi apparatus. It is involved in the transport of proteins from the cis/medial-Golgi to the trans-Golgi network.