Tested Applications
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68262 targets FUS/TLS in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species |
| Full Name | fusion (involved in t(12;16) in malignant liposarcoma) |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 68-75 kDa |
| GenBank Accession Number | BC026062 |
| Gene Symbol | FUS/TLS |
| Gene ID (NCBI) | 2521 |
| RRID | AB_3084462 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35637 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)(PMID: 22640227). Multiple phosphorylation on the N terminus of FUS caused that FUS was detected 68-75 kDa (PMID:24899704).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 FUS/TLS antibody CL488-68262 | Download protocol |
| IF protocol for CL Plus 488 FUS/TLS antibody CL488-68262 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





