CoraLite®594-conjugated FIS1 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-66635

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CL594-66635 (FIS1 antibody) at dilution of 1:50.

FIS1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66635

Clone No.2F10E1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Synonyms

CGI 135, FIS1, FIS1 homolog, hFis1, TPR repeat protein 11, TTC11

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66635 targets FIS1 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1409

  Product name: Recombinant human FIS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC009428

  Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

• Full Name: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009428
• Gene Symbol: FIS1
• Gene ID (NCBI): 51024
• RRID: AB_2883609
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y3D6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (21257639, 21459773, 23333625)