• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EIF4B Polyclonal antibody

EIF4B Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-17917

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

EIF 4B, eIF-4B, PRO1843

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17917 targets EIF4B in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12325

Product name: Recombinant human EIF4B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC073154

Sequence: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS

Predict reactive species
Full Name eukaryotic translation initiation factor 4B
Calculated Molecular Weight 611 aa, 69 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC073154
Gene Symbol EIF4B
Gene ID (NCBI) 1975
RRIDAB_3084012
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23588
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EIF4B is one of the mammalian eukaryotic initiation factors (eIF) that are required for the ATP-dependent binding of mRNA to the 40 S ribosomal subunit, and the other eIF proteins are EIF4A, EIF4F. eIF4B is involved in translation of numerous proliferative or anti-apoptotic mRNAs with highly structured 5'UTR and subsequently affect cell growth and survival. It was reported that false expression and phosphorylation levels of eIF4B are involved in several tumors including breast cancer, cell lymphoblastic leukemia and diffuse large B-cell lymphoma (PMID: 26848623).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EIF4B antibody CL488-17917Download protocol
IF protocol for CL Plus 488 EIF4B antibody CL488-17917Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...