CoraLite®594-conjugated EEA1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594-conjugated EEA1 Monoclonal antibody (CL594-68065)

• Featured Product
• KD/KO Validated

EEA1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-68065

Clone No.1E11E4

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

1E11E4, Early endosome antigen 1, Endosome-associated protein p162, MST105, MSTP105

• 

  IF Staining of HepG2 using CL594-68065

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®594 EEA1 antibody (CL594-68065, Clone: 1E11E4 ) at dilution of 1:200, CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using CL594-68065

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 EEA1 antibody (CL594-68065, Clone: 1E11E4 ) at dilution of 1:200, CoraLite®488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using CL594-68065

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human EEA1 (CL594-68065, Clone:1E11E4) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-68065 targets EEA1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2920189
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Mol Pharm; Glatiramer Acetate Complexes CpG Oligodeoxynucleotides into Nanoparticles and Boosts Their TLR9-Driven Immunity; Authors - Huan Gong