CoraLite® Plus 488-conjugated EEA1 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-68065

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 EEA1 antibody (CL488-68065, Clone: 1E11E4 ) at dilution of 1:200, CL594-phalloidin (red).

• 

  IF Staining of HepG2 using CL488-68065

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 EEA1 antibody (CL488-68065, Clone: 1E11E4 ) at dilution of 1:200, CL594-Phalloidin (red).

• 

  FC experiment of HeLa using CL488-68065

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human EEA1 (CL488-68065, Clone:1E11E4) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

EEA1 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-68065

Clone No.1E11E4

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

ZFYVE2, MSTP105, MST105, Endosome-associated protein p162, Early endosome antigen 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

CL488-68065 targets EEA1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2919561
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Sci (Weinh); In Vivo Reprogramming of Tissue-Derived Extracellular Vesicles for Treating Chronic Tissue Injury Through Metabolic Engineering; Authors - Meng Zhao
	IF	Autophagy; Macrophage autophagy protects against acute kidney injury by inhibiting renal inflammation through the degradation of TARM1; Authors - Xiao-Rong Huang