CoraLite® Plus 488-conjugated DYNLT3 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-11687

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 DYNLT3 antibody (CL488-11687) at dilution of 1:200, CL594-Phalloidin (red).

DYNLT3 Polyclonal Antibody for IF/ICC

Cat No. CL488-11687

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

DYNLT3, Protein 91/23, RP3, TCTE1L, TCTE1XL, TCTEX1L

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11687 targets DYNLT3 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2299

  Product name: Recombinant human DYNLT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC000968

  Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL

• Full Name: dynein, light chain, Tctex-type 3
• Calculated Molecular Weight: 116 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC000968
• Gene Symbol: DYNLT3
• Gene ID (NCBI): 6990
• RRID: AB_3672506
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51808
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Dynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa.