CoraLite® Plus 488-conjugated DYNLT1 Monoclonal antibody

DYNLT1 Monoclonal Antibody for IF/ICC
Cat No. CL488-68312
Clone No.2E3D4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC

T-complex testis-specific protein 1 homolog, Protein CW-1, Protein CW 1, Dynein light chain Tctex-type 1, CW 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68312 targets DYNLT1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33072

Product name: Recombinant human DYNLT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-113 aa of BC029412

Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Predict reactive species
Full Name dynein, light chain, Tctex-type 1
Calculated Molecular Weight 113 aa, 12 kDa
Observed Molecular Weight12 kDa
GenBank Accession NumberBC029412
Gene Symbol DYNLT1
Gene ID (NCBI) 6993
RRIDAB_3672993
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63172
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (PMID: 19448628)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DYNLT1 antibody CL488-68312Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...