DYNLT1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• DYNLT1 Monoclonal antibody (68312-1-Ig)

• Featured Product
• KD/KO Validated

DYNLT1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68312-1-Ig

Clone No.2E3D4

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

2E3D4, CW 1, Dynein light chain Tctex-type 1, Protein CW 1, Protein CW-1

• 

  WB analysis using 68312-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68312-1-Ig (DYNLT1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 68312-1-Ig

  WB result of DYNLT1 antibody (68312-1-Ig; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DYNLT1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C2C12 using 68312-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed C2C12 cells using DYNLT1 antibody (68312-1-Ig, Clone: 2E3D4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of H9C2 using 68312-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed H9C2 cells using DYNLT1 antibody (68312-1-Ig, Clone: 2E3D4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IF/ICC detected in: H9C2 cells, C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68312-1-Ig targets DYNLT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33072

  Product name: Recombinant human DYNLT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-113 aa of BC029412

  Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

• Full Name: dynein, light chain, Tctex-type 1
• Calculated Molecular Weight: 113 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC029412
• Gene Symbol: DYNLT1
• Gene ID (NCBI): 6993
• RRID: AB_2935390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63172
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (PMID: 19448628)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; COP9 signalosome and PRMT5 methylosome complexes are essential regulators of Lis1-dynein-based transport.; Authors - Devanshi Gupta