CoraLite® Plus 488-conjugated DDX3 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-11115

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 DDX3 antibody (CL488-11115) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-11115

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human DDX3 (CL488-11115) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

DDX3 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-11115

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

DDX3X, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX, DDX14

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.8 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11115 targets DDX3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1614

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00571
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.