Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, K-562 cells, C6 cells, PC-12 cells, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human malignant melanoma tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11115-1-AP targets DDX3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1614 Product name: Recombinant human DDX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 312-662 aa of BC011819 Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked |
| Calculated Molecular Weight | 73 kDa |
| Observed Molecular Weight | 73 kDa |
| GenBank Accession Number | BC011819 |
| Gene Symbol | DDX3 |
| Gene ID (NCBI) | 1654 |
| RRID | AB_10896499 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00571 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IF protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IHC protocol for DDX3 antibody 11115-1-AP | Download protocol |
| IP protocol for DDX3 antibody 11115-1-AP | Download protocol |
| WB protocol for DDX3 antibody 11115-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-DDX3X antibody (Cat# 11115-1-AP) has accumulated 47 citations published in high-impact journals including Cell, Nature Communications, Nature Chemistry, Neuron, Journal of Clinical Investigation, Cell Reports, Cell Death & Disease, Cancer Letters, and PLoS Pathogens. Associated research fields encompass oncology (glioblastoma, ovarian, colorectal, pancreatic cancers), neurology (stress granules, stroke, neuropathies), virology (Zika, rotavirus, hepatitis E), immunology (NLRP3 inflammasome, pyroptosis), RNA biology (alternative splicing, m6A modification), and toxicology (aluminum, cisplatin).
| Species | Application | Title |
|---|---|---|
Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules | ||
Nat Chem Chemoproteomic profiling unveils binding and functional diversity of endogenous proteins that interact with endogenous triplex DNA | ||
Nat Commun Circular EZH2-encoded EZH2-92aa mediates immune evasion in glioblastoma via inhibition of surface NKG2D ligands
| ||
Neuron CRISPR-Cas9 Screens Identify the RNA Helicase DDX3X as a Repressor of C9ORF72 (GGGGCC)n Repeat-Associated Non-AUG Translation.
| ||
Neuron Pathogenic DDX3X Mutations Impair RNA Metabolism and Neurogenesis during Fetal Cortical Development. | ||
Theranostics Kindlin-2 enhances c-Myc translation through association with DDX3X to promote pancreatic ductal adenocarcinoma progression |
Reviews
What customers say
The single review for this product is highly positive (5/5). The reviewer used it for Western Blot and Immunoprecipitation on Jurkat T-Cells at a 1:2000 dilution and reported that it worked well, noting that it also binds to different isoforms and protein dimers. Overall, the feedback suggests reliable performance across multiple applications with broad binding capability.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shannon (Verified Customer) (07-19-2022) | Worked well, also binds to different isoforms/protein dimers
 |
