DDX3 Polyclonal antibody

• 

  WB analysis of HepG2 using 11115-1-AP

  WB result of DDX3 antibody (11115-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HepG2 cells.

• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11115-1-AP

  WB result of DDX3 antibody (11115-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HeLa cells.

• 

  WB analysis of NIH/3T3 using 11115-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 11115-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11115-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11115-1-AP

  IP result of anti-DDX3 (IP:11115-1-AP, 4ug; Detection:11115-1-AP 1:300) with HeLa cells lysate 2480ug.

• 

  IHC staining of human malignant melanoma using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 40x lens)..

• 

  IHC staining of human malignant melanoma using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 10x lens)..

• 

  IHC staining of human cervical cancer using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 11115-1-AP (DDX3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 11115-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DDX3 antibody (11115-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 11115-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX3 antibody (11115-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HepG2 using 11115-1-AP

  Immunofluorescent analysis of HepG2 cells using 11115-1-AP (DDX3 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• 

  FC experiment of HeLa using 11115-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DDX3 (11115-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

DDX3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11115-1-AP

Publications(33)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

Synonyms

DDX3X, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX, DDX14

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, HepG2 cells, mouse liver tissue, HT-1080 cells, mouse brain tissue, PC-12 cells, K-562 cells, C6 cells, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human malignant melanoma tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 9 publications below
• WB: See 28 publications below
• IHC: See 5 publications below
• IF: See 9 publications below
• CoIP: See 6 publications below
• RIP: See 2 publications below

Product Information

11115-1-AP targets DDX3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1614

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• RRID: AB_10896499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cell; Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules; Authors - Qinqin Cui
	IF	Neuron; Pathogenic DDX3X Mutations Impair RNA Metabolism and Neurogenesis during Fetal Cortical Development.; Authors - Ashley L Lennox
human	WB	Neuron; CRISPR-Cas9 Screens Identify the RNA Helicase DDX3X as a Repressor of C9ORF72 (GGGGCC)n Repeat-Associated Non-AUG Translation.; Authors - Weiwei Cheng ; KD Validated
human	WB	Cancer Lett; NR4A1 depletion inhibits colorectal cancer progression by promoting necroptosis via the RIG-I-like receptor pathway; Authors - Jinghan Zhu
human	WB	Pharmacol Res; HPV E7-drived ALKBH5 promotes cervical cancer progression by modulating m6A modification of PAK5; Authors - Fu-Chun Huo ; KD Validated
mouse	WB,IF,CoIP	Ecotoxicol Environ Saf; Aluminum exposure induces central nervous system impairment via activating NLRP3-medicated pyroptosis pathway; Authors - Wudi Hao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Shannon (Verified Customer) (07-19-2022)

Worked well, also binds to different isoforms/protein dimers

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Jurkat T-Cells

DDX3 Antibody Western Blot,Immunoprecipitation validation (1:2000 dilution) in Jurkat T-Cells (Cat no:11115-1-AP)