Use Able AI chat for product recommendations

Cyclin E1 Recombinant monoclonal antibody, PBS Only (Detector)

Cyclin E1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 82700-8-PBS
Clone No.240136G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

CCNE1, 240136G9, CCNE, Cyclin E, G1/S specific cyclin E1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82700-8-PBS targets Cyclin E1 as part of a matched antibody pair:

MP00361-2: 82700-6-PBS capture and 82700-8-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2110

Product name: Recombinant human Cyclin E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 111-410 aa of BC035498

Sequence: ANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Predict reactive species
Full Name cyclin E1
Calculated Molecular Weight 410 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC035498
Gene Symbol Cyclin E1
Gene ID (NCBI) 898
RRIDAB_3670532
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24864
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cyclin E1 (CCNE1) is a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNE1, an essential cyclin activating Cdk2, regulates the G1-S phase transition of the mammalian cell division cycle. Its timing expression plays a direct role in the initiation of DNA replication , the control of histone biosynthesis, and the centrosome cycle. CCNE1 is associated with disease progression in various malignancies and is associated clinically with poor prognosis. Two bands of Cyclin E1 were expressed in U2OS and MDA-MB-231 cells (PMID:9858585, PMID: 24112607).

Loading...
||
New chat

Able

正在加载,请稍候...