Tested Applications
| Positive IF/ICC detected in | Neuro-2a cells |
| Positive FC (Intra) detected in | SH-SY5Y cells, Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-60135 targets Chromogranin A in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Predict reactive species |
| Full Name | chromogranin A (parathyroid secretory protein 1) |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC006459 |
| Gene Symbol | Chromogranin A |
| Gene ID (NCBI) | 1113 |
| RRID | AB_2923917 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P10645 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 Chromogranin A antibody CL594-60135 | Download protocol |
| IF protocol for CL594 Chromogranin A antibody CL594-60135 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





