CoraLite® Plus 488-conjugated Chromogranin A Polyclonal antibody

Chromogranin A Polyclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL488-10529

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

CGA, CHGA, AL-11, Chromogranin-A, EA-92

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse pancreas tissue
Positive IF/ICC detected inNeuro-2a cells
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-10529 targets Chromogranin A in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0807

Product name: Recombinant human CHGA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-457 aa of BC006459

Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Predict reactive species
Full Name chromogranin A (parathyroid secretory protein 1)
Calculated Molecular Weight 51 kDa
GenBank Accession NumberBC006459
Gene Symbol Chromogranin A
Gene ID (NCBI) 1113
RRIDAB_2883077
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10645
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Chromogranin A antibody CL488-10529Download protocol
IF protocol for CL Plus 488 Chromogranin A antibody CL488-10529Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

bioRxiv

Pathobiont-triggered induction of epithelial IDO1 drives regional susceptibility to Inflammatory Bowel Disease

Authors - Paige N Spencer
Loading...
||
New chat

Able

正在加载,请稍候...