Filter:
Tested Applications
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
CL488-26592 targets Cardiac Troponin T in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24911 Product name: Recombinant human cTnT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC002653 Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP Predict reactive species |
| Full Name | troponin T type 2 (cardiac) |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 34-40 kDa |
| GenBank Accession Number | BC002653 |
| Gene Symbol | Cardiac Troponin T |
| Gene ID (NCBI) | 7139 |
| RRID | AB_3084097 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P45379 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Cardiac Troponin T antibody CL488-26592 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
