Cardiac Troponin T Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cardiac Troponin T Polyclonal antibody (26592-1-AP)

Cardiac Troponin T Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 26592-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

cTnT, TNNT2, Troponin T, cardiac muscle

• 

  WB analysis using 26592-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26592-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody at dilution of 1:500 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody at dilution of 1:500 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 26592-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Cardiac Troponin T antibody (26592-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of H9C2 using 26592-1-AP

  1x10^6 H9C2 cells were intracellularly stained with 0.25 ug Cardiac Troponin T Polyclonal antibody (26592-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cardiac Troponin T in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue, rat heart tissue
• Positive IHC detected in: human heart tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue
• Positive FC (Intra) detected in: H9C2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26592-1-AP targets Cardiac Troponin T in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24911

  Product name: Recombinant human cTnT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC002653

  Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP

• Full Name: troponin T type 2 (cardiac)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC002653
• Gene Symbol: Cardiac Troponin T
• Gene ID (NCBI): 7139
• RRID: AB_2880566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45379
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Cardiac Troponin T Polyclonal antibody (Cat# 26592-1-AP) has 14 citations published in journals including Cell Metabolism, Nature Communications, Signal Transduction and Targeted Therapy, Advanced Science, Biomaterials, Free Radical Biology and Medicine, European Journal of Pharmacology, Nutrients, Frontiers in Physiology, Acta Diabetologica, British Journal of Pharmacology, Cardiovascular Toxicology, Clinical and Experimental Hypertension, and European Journal of Pharmaceutical Sciences. Research fields span cardiomyopathy, heart failure, cardiac fibrosis, sepsis-induced cardiac injury, metabolic reprogramming, and drug-induced cardiotoxicity.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF	Signal Transduct Target Ther; Thiamine-modified metabolic reprogramming of human pluripotent stem cell-derived cardiomyocyte under space microgravity; Authors - Xinglong Han
rat,human	IF	Cell Metab; O-GlcNAcylation-mediated endothelial metabolic memory contributes to cardiac damage via small extracellular vesicles; Authors - Mingge Ding
mouse	IF	Nat Commun; Fibroblast-specific PRMT5 deficiency suppresses cardiac fibrosis and left ventricular dysfunction in male mice; Authors - Yasufumi Katanasaka
rat	WB	Adv Sci (Weinh); Aloe Emodin Alleviates Radiation-Induced Heart Disease via Blocking P4HB Lactylation and Mitigating Kynurenine Metabolic Disruption; Authors - Fan Ouyang
mouse	IF	Biomaterials; Targeted immunomodulation therapy for cardiac repair by platelet membrane engineering extracellular vesicles via hitching peripheral monocytes.; Authors - Qiyu Li
human	IF	Free Radic Biol Med; SIRT3 promotes metabolic maturation of human iPSC-derived cardiomyocytes via OPA1-controlled mitochondrial dynamics; Authors - Rui Wang