• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Calnexin Polyclonal antibody

Calnexin Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10427

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CANX, CNX, IP90, Major histocompatibility complex class I antigen-binding protein p88, P90

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10427 targets Calnexin in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0697

Product name: Recombinant human Calnexin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-273 aa of BC003552

Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS

Predict reactive species
Full Name calnexin
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC003552
Gene Symbol Calnexin
Gene ID (NCBI) 821
RRIDAB_2918978
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27824
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Calnexin antibody CL488-10427Download protocol
IF protocol for CL Plus 488 Calnexin antibody CL488-10427Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...