Calnexin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Calnexin Polyclonal antibody (10427-2-AP)

• Featured Product
• KD/KO Validated

Calnexin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10427-2-AP

Publications(798)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

CANX, CNX, IP90, Major histocompatibility complex class I antigen-binding protein p88, P90

• 

  WB analysis using 10427-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10427-2-AP (Calnexin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10427-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10427-2-AP (Calnexin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10427-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10427-2-AP (Calnexin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10427-2-AP

  WB result of Calnexin antibody (10427-2-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Calnexin transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10427-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10427-2-AP (Calnexin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10427-2-AP (Calnexin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10427-2-AP (Calnexin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10427-2-AP (Calnexin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10427-2-AP (Calnexin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 10427-2-AP (Calnexin antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10427-2-AP (CANX antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10427-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10427-2-AP (CANX antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 10427-2-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed SKOV-3 cells using Calnexin antibody (10427-2-AP) at dilution of 1:1200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 10427-2-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Calnexin antibody (10427-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 10427-2-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Calnexin antibody (10427-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 10427-2-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Calnexin antibody (10427-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), PDI antibody (66422-1-Ig, Clone: 2E6A11, Magenta), F-actin (orange).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10427-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Calnexin antibody (10427-2-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10427-2-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 10427-2-AP (Calnexin antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10427-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Calnexin antibody (10427-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 10427-2-AP

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human Calnexin (10427-2-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, K-562 cells, MCF-7 cells, NIH/3T3 cells, U2OS cells, RAW 264.7 cells
• Positive IHC detected in: human breast cancer tissue, human cervical cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HepG2 cells, SKOV-3 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10427-2-AP targets Calnexin in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, hamster, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0697

  Product name: Recombinant human Calnexin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC003552

  Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS

• Full Name: calnexin
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC003552
• Gene Symbol: Calnexin
• Gene ID (NCBI): 821
• RRID: AB_2069033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27824
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Signal Transduct Target Ther; Elaiophylin triggers paraptosis and preferentially kills ovarian cancer drug-resistant cells by inducing MAPK hyperactivation; Authors - Guan-Nan Li
human	IF	Signal Transduct Target Ther; Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) membrane (M) protein inhibits type I and III interferon production by targeting RIG-I/MDA-5 signaling.; Authors - Yi Zheng
human	WB	Signal Transduct Target Ther; The interferon-stimulated exosomal hACE2 potently inhibits SARS-CoV-2 replication through competitively blocking the virus entry.; Authors - Junsong Zhang
human	IF	Signal Transduct Target Ther; SARS-CoV-2 NSP5 and N protein counteract the RIG-I signaling pathway by suppressing the formation of stress granules.; Authors - Yi Zheng
human	IF	Nature; A virally encoded high-resolution screen of cytomegalovirus dependencies; Authors - Yaara Finkel
human, mouse	WB	Nature; CLCC1 governs ER bilayer equilibration to maintain lipid homeostasis.; Authors - Lingzhi Wu

Reviews

5.0 out of 5

4 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Zakia (Verified Customer) (01-06-2026)

The Calnexin rabbit polyclonal antibody performed excellently in our study using mouse brain samples. The antibody produced a strong and specific signal, with a clearly defined band at approximately 90 kDa, which is consistent with the expected molecular weight of Calnexin. Background signal was minimal, allowing for confident interpretation of results.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: mice nipsnap brain sample

Calnexin Antibody Western Blot validation (1:3000 dilution) in mice nipsnap brain sample (Cat no:10427-2-AP)

Guo-rong (Verified Customer) (02-06-2023)

Clear bands can be detected in total cell lysates rather than in extracellular vesicles, as a good EV exclusive marker

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: ARPE-19

Calnexin Antibody Western Blot validation (1:5000 dilution) in ARPE-19 (Cat no:10427-2-AP)

Saba (Verified Customer) (03-14-2022)

The band of the antibody was so sharp and specific. The dilution I used was 1:4000 and it worked perfectly.

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000

Meliti (Verified Customer) (09-25-2019)

1:1000 dilution in 5%milk PBST O/N incubation for all antibodies depicted which all come from Proteintech 1:5000 anti rabbit HRP in 5%milk PBST for 1h

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human HEK293 WCEs and exosomes released from these cells and purified by size exclusion chromatography

Calnexin Antibody Western Blot, validation (1:1000 dilution) in Human HEK293 WCEs and exosomes released from these cells and purified by size exclusion chromatography (Cat no:10427-2-AP)